Request QuoteCatalog Number: xP364464EODSize: 0.2-1mg

Request Quote

Recombinant Zinc resistance-associated protein (zraP)

Recombinant Zinc resistance-associated protein (zraP) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP364464EODYeast1mgQuote
EP364464EODE. coli1mgQuote
BP364464EODBaculovirus200ugQuote
MP364464EODMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli O157:H7
UniProt IDP0AAB0
Gene NamezraP; Locus:Z5578, ECs4925
Protein NameZinc resistance-associated protein
Region Expressed27-141
Expression Tag6xHis
Purity>90%
AA SequenceHGGHGMWQQNAAPLTSEQQTAWQKIHNDFYAQSSALQQQLVTKRYEYNALLAANPPDSSK INAVAKEMENLRQSLDELRVKRDIAMAEAGIPRGAGMGMGYGGCGGGGHMGMGHW
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review