Request QuoteCatalog Number: xP359429ENVSize: 0.2-1mg

Request Quote

Recombinant Zinc resistance-associated protein (zraP)

Recombinant Zinc resistance-associated protein (zraP) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP359429ENVYeast1mgQuote
EP359429ENVE. coli1mgQuote
BP359429ENVBaculovirus200ugQuote
MP359429ENVMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli (strain K12)
UniProt IDP0AAA9
Gene NamezraP; aka: yjaI, zra; Locus:b4002, JW5546
Protein NameZinc resistance-associated protein
Region Expressed27-141
Expression Tag6xHis
Purity>90%
AA SequenceHGGHGMWQQNAAPLTSEQQTAWQKIHNDFYAQSSALQQQLVTKRYEYNALLAANPPDSSK INAVAKEMENLRQSLDELRVKRDIAMAEAGIPRGAGMGMGYGGCGGGGHMGMGHW
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review