Request QuoteCatalog Number: xP527151GGOSize: 0.2-1mg

Request Quote

Recombinant Zinc metalloproteinase/disintegrin

Recombinant Zinc metalloproteinase/disintegrin can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP527151GGOYeast1mgQuote
EP527151GGOE. coli1mgQuote
BP527151GGOBaculovirus200ugQuote
MP527151GGOMammalian Cell200ugQuote

Protein Information

SpeciesGloydius brevicaudus (Korean slamosa snake) (Agkistrodon halys brevicaudus)
UniProt IDO93518
Gene Name
Protein NameZinc metalloproteinase/disintegrin Cleaved into the following 2 chains: 1. Metalloproteinase
Region Expressed12-103
Expression Tag6xHis
Purity>90%
AA SequenceLGTDIVSPPVCGNELLEVGEECDCGTPENCQNECCDAATCKLKSGSQCGHGDCCEQCKFS KSGTECRESMSECDPAEHCSGQCSECPADVFH
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review