Request QuoteCatalog Number: xP384924OFFSize: 0.2-1mg

Request Quote

Recombinant Zinc finger A20 and AN1 domain-containing stress-associated protein 1 (SAP1)

Recombinant Zinc finger A20 and AN1 domain-containing stress-associated protein 1 (SAP1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP384924OFFYeast1mgQuote
EP384924OFFE. coli1mgQuote
BP384924OFFBaculovirus200ugQuote
MP384924OFFMammalian Cell200ugQuote

Protein Information

SpeciesOryza sativa subsp. indica (Rice)
UniProt IDA2Z2J6
Gene NameSAP1; aka: ISAP1; ORFs:OsI_030789
Protein NameZinc finger A20 and AN1 domain-containing stress-associated protein 1
Region Expressed1-164
Expression Tag6xHis
Purity>90%
AA SequenceMAQRDKKDQEPTELRAPEITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVL DKQPPRPAAPLVEPQAPLPPPVEEMASALATAPAPVAKTSAVNRCSRCRKRVGLTGFRCR CGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNPVVRAAKIVRF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review