Request QuoteCatalog Number: xP324893FIGSize: 0.2-1mg

Request Quote

Recombinant Wound-induced protein 1 (WUN1)

Recombinant Wound-induced protein 1 (WUN1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP324893FIGYeast1mgQuote
EP324893FIGE. coli1mgQuote
BP324893FIGBaculovirus200ugQuote
MP324893FIGMammalian Cell200ugQuote

Protein Information

SpeciesSolanum tuberosum (Potato)
UniProt IDP20144
Gene NameWUN1
Protein NameWound-induced protein 1
Region Expressed1-105
Expression Tag6xHis
Purity>90%
AA SequenceMQILTGTAKFDNASFQFLHKTIDVFGSVVLVEGCDPTRSITWVHAWTVTDGVITQVREYF NTSLTVTRFGKSDISSITTLHCPSVWESSLPNRVGKSVPGLVLAL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review