Request QuoteCatalog Number: xP362811CYVSize: 0.2-1mg

Request Quote

Recombinant Whey acidic protein (WAP)

Recombinant Whey acidic protein (WAP) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP362811CYVYeast1mgQuote
EP362811CYVE. coli1mgQuote
BP362811CYVBaculovirus200ugQuote
MP362811CYVMammalian Cell200ugQuote

Protein Information

SpeciesCamelus dromedarius (Dromedary) (Arabian camel)
UniProt IDP09837
Gene NameWAP
Protein NameWhey acidic protein
Region Expressed1-117
Expression Tag6xHis
Purity>90%
AA SequenceLAPALSLPGQAVCPELSSSEDNACIISCVNDESCPQGTKCCARSPCSRSCTVPLMVSSPE PVLKDGRCPWVQTPLTAKHCLEKNDCSRDDQCEGNKKCCFSSCAMRCLDPVTEDSFQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review