Request QuoteCatalog Number: xP395558DMGSize: 0.2-1mg

Request Quote

Recombinant Vitelline membrane protein Vm32E (Vm32E)

Recombinant Vitelline membrane protein Vm32E (Vm32E) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP395558DMGYeast1mgQuote
EP395558DMGE. coli1mgQuote
BP395558DMGBaculovirus200ugQuote
MP395558DMGMammalian Cell200ugQuote

Protein Information

SpeciesDrosophila sechellia (Fruit fly)
UniProt IDA4UM15
Gene NameVm32E; ORFs:GM11107
Protein NameVitelline membrane protein Vm32E
Region Expressed18-118
Expression Tag6xHis
Purity>90%
AA SequenceSCPYAAPAQAYSAPAAPSGYPAPPCPTNYLFSCQPNLAPAPCAQEAQAPAYGSAGAYTEQ VPRYVGSPNREQVQQFHQRIGMAALMEELRGLGQGIQGQQY
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review