Request QuoteCatalog Number: xP465492DMRSize: 0.2-1mg

Request Quote

Recombinant Vitelline membrane protein Vm32E (Vm32E)

Recombinant Vitelline membrane protein Vm32E (Vm32E) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP465492DMRYeast1mgQuote
EP465492DMRE. coli1mgQuote
BP465492DMRBaculovirus200ugQuote
MP465492DMRMammalian Cell200ugQuote

Protein Information

SpeciesDrosophila yakuba (Fruit fly)
UniProt IDB4P184
Gene NameVm32E; ORFs:GE12948
Protein Name
Region Expressed18-115
Expression Tag6xHis
Purity>90%
AA SequenceSCPYAAPAAAPAPAAPSGYPAPPCPTNYLFSCQPNLAPAPCAQEAPAYGSAGAYTEQVPQ YVGNPSREQVQQFHQRIGMAALMEELRGLGQGIQGQQY
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review