Request QuoteCatalog Number: xP465423DMBSize: 0.2-1mg

Request Quote

Recombinant Vitelline membrane protein Vm32E (Vm32E)

Recombinant Vitelline membrane protein Vm32E (Vm32E) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP465423DMBYeast1mgQuote
EP465423DMBE. coli1mgQuote
BP465423DMBBaculovirus200ugQuote
MP465423DMBMammalian Cell200ugQuote

Protein Information

SpeciesDrosophila persimilis (Fruit fly)
UniProt IDB4G9V0
Gene NameVm32E; ORFs:GL18579
Protein Name
Region Expressed20-122
Expression Tag6xHis
Purity>90%
AA SequenceSCSSSYAAPAPAAAPASSYSSVPAPPCPKNYLFSCQPNLVPAPCAQQAAPAAYGSAGAYT EQVPSYIGFAPYQQLQQYHQRIGNAALIDELRSLGQGIQGQQY
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review