Request QuoteCatalog Number: xP362138TBDSize: 0.2-1mg

Request Quote

Recombinant Vitelline coat lysin

Recombinant Vitelline coat lysin can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP362138TBDYeast1mgQuote
EP362138TBDE. coli1mgQuote
BP362138TBDBaculovirus200ugQuote
MP362138TBDMammalian Cell200ugQuote

Protein Information

SpeciesTegula pfeifferi (Pfeiffer's top shell)
UniProt IDP07447
Gene Name
Protein NameVitelline coat lysin
Region Expressed1-118
Expression Tag6xHis
Purity>90%
AA SequenceYGPGVRVVVHQNQRLGYRNNGIVKTAVMRVFDGRANSYVNKHPAGQPYLRMPIWTPGVRV HQNTDLGYRKNAFREYMRWMGKSCALNVRERYTLNPDQRRFLNIPGARMPIRTPGAFR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review