Request QuoteCatalog Number: xP332986SWMSize: 0.2-1mg

Request Quote

Recombinant Virulence protein VsdF (vsdF)

Recombinant Virulence protein VsdF (vsdF) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP332986SWMYeast1mgQuote
EP332986SWME. coli1mgQuote
BP332986SWMBaculovirus200ugQuote
MP332986SWMMammalian Cell200ugQuote

Protein Information

SpeciesSalmonella dublin
UniProt IDP24421
Gene NamevsdF
Protein NameVirulence protein VsdF
Region Expressed1-119
Expression Tag6xHis
Purity>90%
AA SequenceMLRATKVCIYPTPEQAEHLNAQFGAVRFVYSKSLHIKKHAYQRHGVSLTPRKDIKPLLAV AKKFRKFRKFRKYAWLKEYDSIALQQAVINLDVAFSNCFNPKLKARFPMFKRKHGKLLG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review