Request QuoteCatalog Number: xP025781BOSize: 0.2-1mg

Request Quote

Recombinant Vesicle-associated membrane protein 2 (VAMP2)

Recombinant Vesicle-associated membrane protein 2 (VAMP2) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP025781BOYeast1mgQuote
EP025781BOE. coli1mgQuote
BP025781BOBaculovirus200ugQuote
MP025781BOMammalian Cell200ugQuote

Protein Information

SpeciesBos taurus (Bovine)
UniProt IDP63026
Gene NameVAMP2; aka: SYB2
Protein NameVesicle-associated membrane protein 2
Region Expressed2-116
Expression Tag6xHis
Purity>90%
AA SequenceSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLS ELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFSS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review