Request QuoteCatalog Number: xP025786MOSize: 0.2-1mg

Request Quote

Recombinant Vesicle-associated membrane protein 8 (Vamp8)

Recombinant Vesicle-associated membrane protein 8 (Vamp8) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP025786MOYeast1mgQuote
EP025786MOE. coli1mgQuote
BP025786MOBaculovirus200ugQuote
MP025786MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDO70404
Gene NameVamp8
Protein NameVesicle-associated membrane protein 8
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMEEASGSAGNDRVRNLQSEVEGVKNIMTQNVERILSRGENLDHLRNKTEDLEATSEHFKT TSQKVARKFWWKNVKMIVIICVIVLIIVILIILFATGTIPT
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review