Request QuoteCatalog Number: xP514903LRMSize: 0.2-1mg

Request Quote

Recombinant Venom protein TxLP11

Recombinant Venom protein TxLP11 can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514903LRMYeast1mgQuote
EP514903LRME. coli1mgQuote
BP514903LRMBaculovirus200ugQuote
MP514903LRMMammalian Cell200ugQuote

Protein Information

SpeciesLychas mucronatus (Chinese swimming scorpion)
UniProt IDC6ZH25
Gene Name
Protein NameVenom protein TxLP11
Region Expressed23-117
Expression Tag6xHis
Purity>90%
AA SequenceRRCGGRGRRIKIKKIVRKLRPIVRVMKVITRMRTSRPRPRLRPCNSSDLQTTSYQVMQPI SPKLKSCPVSLAICNRKCSRRGMKGRCQRRECVCY
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review