Request QuoteCatalog Number: xP316768LRMSize: 0.2-1mg

Request Quote

Recombinant Venom protein 29

Recombinant Venom protein 29 can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP316768LRMYeast1mgQuote
EP316768LRME. coli1mgQuote
BP316768LRMBaculovirus200ugQuote
MP316768LRMMammalian Cell200ugQuote

Protein Information

SpeciesLychas mucronatus (Chinese swimming scorpion)
UniProt IDP0CJ08
Gene Name
Protein NameVenom protein 29
Region Expressed19-123
Expression Tag6xHis
Purity>90%
AA SequenceFTYEEKKQAFCSLPKVYQIRLLDCLIDRGSENDKEVVNAVYKCMNEHSDVDGKADAMMKA VCNEEIFATNRNLILCMLVNPPKLEHSERTNDDDLEAVKYCLVNG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review