Request QuoteCatalog Number: xP406186DJDSize: 0.2-1mg

Request Quote

Recombinant Venom nerve growth factor 2

Recombinant Venom nerve growth factor 2 can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP406186DJDYeast1mgQuote
EP406186DJDE. coli1mgQuote
BP406186DJDBaculovirus200ugQuote
MP406186DJDMammalian Cell200ugQuote

Protein Information

SpeciesDemansia vestigiata (Lesser black whip snake) (Demansia atra)
UniProt IDA6MFL6
Gene Name
Protein NameVenom nerve growth factor 2
Region Expressed126-242
Expression Tag6xHis
Purity>90%
AA SequenceENHPVNDHGEYSVCDSVSVWVNKTTATDIKGKPVTVMVDVNLNNHVYKQYFFETKCKNPN PVPSGCRGIDSRHWNSYCTTTQSFVKALTKEGNQASWRFIRIDTACVCVISRKTGNF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review