Request QuoteCatalog Number: xP008674HUSize: 0.2-1mg

Request Quote

Recombinant Vascular endothelial growth factor D (FIGF)

Recombinant Vascular endothelial growth factor D (FIGF) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP008674HUYeast1mgQuote
EP008674HUE. coli1mgRP075544h
BP008674HUBaculovirus200ugQuote
MP008674HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDO43915
Gene NameFIGF; aka: VEGFD
Protein NameVascular endothelial growth factor D
Region Expressed89-205
Expression Tag6xHis
Purity>90%
AA SequenceFAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNE ESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review