Request QuoteCatalog Number: xP025866DMJSize: 0.2-1mg

Request Quote

Recombinant Vacuolar ATPase assembly integral membrane protein VMA21 (GD14890)

Recombinant Vacuolar ATPase assembly integral membrane protein VMA21 (GD14890) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP025866DMJYeast1mgQuote
EP025866DMJE. coli1mgQuote
BP025866DMJBaculovirus200ugQuote
MP025866DMJMammalian Cell200ugQuote

Protein Information

SpeciesDrosophila simulans (Fruit fly)
UniProt IDB4QJ33
Gene NameORFs:GD14890
Protein NameVacuolar ATPase assembly integral membrane protein VMA21
Region Expressed1-105
Expression Tag6xHis
Purity>90%
AA SequenceMSTKNKKAAGGNGGAPKQTRQQSHDSQDYSSFKTVLFYCMLIVFLPVLTFFVLKGFVLDQ FLDISEVKVNIASAVGAVVALHIALGLYIYRAYFGAPGSKGSKTD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review