Request QuoteCatalog Number: xP493317EPVSize: 0.2-1mg

Request Quote

Recombinant Urease subunit gamma (ureA)

Recombinant Urease subunit gamma (ureA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP493317EPVYeast1mgQuote
EP493317EPVE. coli1mgQuote
BP493317EPVBaculovirus200ugQuote
MP493317EPVMammalian Cell200ugQuote

Protein Information

SpeciesCyanothece sp. (strain PCC 7425 / ATCC 29141)
UniProt IDB8HW52
Gene NameureA; Locus:Cyan7425_2271
Protein NameUrease subunit gamma
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMQLTPQEKDKLLIFTAALLAERRKARGLKLNYPEAIAYISAAILEGARDGRTVSELMNYG TTLLSRNDVMEGIAEMIHEIQVEATFPDGTKLVTVHNPIQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review