Request QuoteCatalog Number: xP493289DOGSize: 0.2-1mg

Request Quote

Recombinant Urease subunit gamma (ureA)

Recombinant Urease subunit gamma (ureA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP493289DOGYeast1mgQuote
EP493289DOGE. coli1mgQuote
BP493289DOGBaculovirus200ugQuote
MP493289DOGMammalian Cell200ugQuote

Protein Information

SpeciesArthrobacter chlorophenolicus (strain A6 / ATCC 700700 / DSM 12829 / JCM 12360)
UniProt IDB8HA05
Gene NameureA; Locus:Achl_0390
Protein NameUrease subunit gamma
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMHLMPREQEKLMIVVAADLARRRQSRGLKLNYPEAVAIISYELIEGARDGRTVADLMSYG TTILTREDVMEGVPEMIHDVQIEATFPDGTKLVTVHDPIR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review