Request QuoteCatalog Number: xP541583FOFSize: 0.2-1mg

Request Quote

Recombinant Urease subunit gamma (ureA)

Recombinant Urease subunit gamma (ureA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP541583FOFYeast1mgQuote
EP541583FOFE. coli1mgQuote
BP541583FOFBaculovirus200ugQuote
MP541583FOFMammalian Cell200ugQuote

Protein Information

SpeciesStreptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350)
UniProt IDB1W5G7
Gene NameureA; Locus:SGR_6295
Protein NameUrease subunit gamma
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMQLTPHEQERLLIHVAADVAEKRRARGLRLNHPEAVALITSHLLEGARDGRTVAELMVSG RTLLTRDDVMEGIPEMLHDVQVEATFPDGTKLVTVHDPIV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review