Request QuoteCatalog Number: xP457815FQASize: 0.2-1mg

Request Quote

Recombinant Urease subunit gamma (ureA)

Recombinant Urease subunit gamma (ureA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP457815FQAYeast1mgQuote
EP457815FQAE. coli1mgQuote
BP457815FQABaculovirus200ugQuote
MP457815FQAMammalian Cell200ugQuote

Protein Information

SpeciesSynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)
UniProt IDB1XLM3
Gene NameureA; Locus:SYNPCC7002_A1319
Protein Name
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMQLSPQEKDKLLIFTAFLVAERRKNKGLKLNYPEAVAYISGLILEGAREGKLVAELMSEG QTWLTRDDVMAGVAEMVDEVQVEATFPDGTKLVTIHNPIQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review