Request QuoteCatalog Number: xP451664DZSSize: 0.2-1mg

Request Quote

Recombinant Urease subunit gamma (ureA)

Recombinant Urease subunit gamma (ureA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP451664DZSYeast1mgQuote
EP451664DZSE. coli1mgQuote
BP451664DZSBaculovirus200ugQuote
MP451664DZSMammalian Cell200ugQuote

Protein Information

SpeciesCupriavidus taiwanensis (strain R1 / LMG 19424) (Ralstonia taiwanensis (strain LMG 19424) )
UniProt IDB3R3Z9
Gene NameureA; Locus:RALTA_A1066
Protein Name
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMELTPREKDKLLIFTAALLAERRKARGLKLNYPEAVALITAAIMEGARDGRTVAELMHEG TTVLTREDVMDGIAEMIPEIQVEATFPDGTKLVTVHHPIV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review