Request QuoteCatalog Number: xP450177BXPSize: 0.2-1mg

Request Quote

Recombinant Urease subunit gamma (ureA)

Recombinant Urease subunit gamma (ureA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP450177BXPYeast1mgQuote
EP450177BXPE. coli1mgQuote
BP450177BXPBaculovirus200ugQuote
MP450177BXPMammalian Cell200ugQuote

Protein Information

SpeciesBurkholderia ambifaria (strain MC40-6)
UniProt IDB1YUG1
Gene NameureA; Locus:BamMC406_0792
Protein Name
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMKLTPREKDKLLIFTAALLAERRRARGLKLNYPEAVAFITAALMEAARDGKTVAEVMHYG TTLLTRDDVMDGVPEMIPDIQVEATFPDGTKLVTVHHPIP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review