Request QuoteCatalog Number: xP543852BXQSize: 0.2-1mg

Request Quote

Recombinant Urease subunit gamma (ureA)

Recombinant Urease subunit gamma (ureA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP543852BXQYeast1mgQuote
EP543852BXQE. coli1mgQuote
BP543852BXQBaculovirus200ugQuote
MP543852BXQMammalian Cell200ugQuote

Protein Information

SpeciesBurkholderia cenocepacia (strain MC0-3)
UniProt IDB1JX31
Gene NameureA; Locus:Bcenmc03_0872
Protein NameUrease subunit gamma
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMKLTPREKDKLLIFTAALLAERRRARGLKLNYPEAIAFITAALMEAARDGKTVAEVMHYG TTLLTRDDVMDGVPEMIPDIQVEATFPDGTKLVTVHHPIP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review