Request QuoteCatalog Number: xP384476BPUSize: 0.2-1mg

Request Quote

Recombinant Urease subunit beta (ureB)

Recombinant Urease subunit beta (ureB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP384476BPUYeast1mgQuote
EP384476BPUE. coli1mgQuote
BP384476BPUBaculovirus200ugQuote
MP384476BPUMammalian Cell200ugQuote

Protein Information

SpeciesBurkholderia pseudomallei (strain 668)
UniProt IDA3NCL6
Gene NameureB; Locus:BURPS668_3075
Protein NameUrease subunit beta
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMIPGELVIDDGEHTLNAGRHTIALVVANTGDRPVQVGSHYHFHEVNDALSFDRAAARGFR LNIAAGTAVRFEPGQTRTIELVELGGARAVYGFQGKVMGPL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review