Request QuoteCatalog Number: xP501061FFUSize: 0.2-1mg

Request Quote

Recombinant Urease subunit beta (ureB)

Recombinant Urease subunit beta (ureB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP501061FFUYeast1mgQuote
EP501061FFUE. coli1mgQuote
BP501061FFUBaculovirus200ugQuote
MP501061FFUMammalian Cell200ugQuote

Protein Information

SpeciesPseudomonas fluorescens (strain SBW25)
UniProt IDC3K5A2
Gene NameureB; Locus:PFLU_0579
Protein NameUrease subunit beta
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMIPGEYQIQPGDIELNVGRRTVTLSVANSGDRPIQVGSHYHFFETNDALTFDRAASRGMR LNIPAGTAVRFEPGQSREIELVDLSGGRRVFGFAGRIMGDL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review