Request QuoteCatalog Number: xP490018TNXSize: 0.2-1mg

Request Quote

Recombinant Urease subunit beta (ureB)

Recombinant Urease subunit beta (ureB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP490018TNXYeast1mgQuote
EP490018TNXE. coli1mgQuote
BP490018TNXBaculovirus200ugQuote
MP490018TNXMammalian Cell200ugQuote

Protein Information

SpeciesThioalkalivibrio sp. (strain HL-EbGR7)
UniProt IDB8GQ25
Gene NameureB; Locus:Tgr7_3103
Protein NameUrease subunit beta
Region Expressed1-112
Expression Tag6xHis
Purity>90%
AA SequenceMIPGEFLLADGEIELNADREGRPFQVTNTGDRPIQVGSHYHFHEVNNALDFDRDAALGLR LDIPAGTAVRFEPGQTRTVSLVPFAGERRVYGFQGRVMGPLPTAPDEPEQTS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review