Request QuoteCatalog Number: xP463212RKLSize: 0.2-1mg

Request Quote

Recombinant Urease subunit beta (ureB)

Recombinant Urease subunit beta (ureB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP463212RKLYeast1mgQuote
EP463212RKLE. coli1mgQuote
BP463212RKLBaculovirus200ugQuote
MP463212RKLMammalian Cell200ugQuote

Protein Information

SpeciesRhizobium etli (strain CIAT 652)
UniProt IDB3PXB6
Gene NameureB; Locus:RHECIAT_CH0003551
Protein Name
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMIPGEIIAASGDIELNAGAPTVTLEVSNTGDRPVQVGSHYHFAETNAGLSFDRAAAHGKR LDIPSGTAVRFEPGQTRSVTLIPLAGKREVYGFRQLVMGKL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review