Request QuoteCatalog Number: xP454142OENSize: 0.2-1mg

Request Quote

Recombinant Urease subunit beta (ureB)

Recombinant Urease subunit beta (ureB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP454142OENYeast1mgQuote
EP454142OENE. coli1mgQuote
BP454142OENBaculovirus200ugQuote
MP454142OENMammalian Cell200ugQuote

Protein Information

SpeciesOpitutus terrae (strain DSM 11246 / PB90-1)
UniProt IDB1ZP07
Gene NameureB; Locus:Oter_4223
Protein Name
Region Expressed1-102
Expression Tag6xHis
Purity>90%
AA SequenceMIPGEIIPAAGLPLDANTGLETKVLTVANTGDRPIQVGSHYHFFETNEALEFDRDATRGF RLNIPAGTAVRFEAGDTKRVELVALAGAREVYGLNARVNGKL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review