Request QuoteCatalog Number: xP453909AZXSize: 0.2-1mg

Request Quote

Recombinant Urease subunit beta (ureB)

Recombinant Urease subunit beta (ureB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP453909AZXYeast1mgQuote
EP453909AZXE. coli1mgQuote
BP453909AZXBaculovirus200ugQuote
MP453909AZXMammalian Cell200ugQuote

Protein Information

SpeciesAlteromonas macleodii (strain DSM 17117 / Deep ecotype)
UniProt IDB4RSX8
Gene NameureB; Locus:MADE_1014285
Protein Name
Region Expressed1-102
Expression Tag6xHis
Purity>90%
AA SequenceMIPGEIKTDSGDRELNVGRPRIKIKVANAGDRPIQVGSHYHFYEVNNALKFDREATKGYR LDITSSTAIRFEPGQEREVTLIPYQGSRTVIGFQGKVQGVLS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review