Request QuoteCatalog Number: xP452150BXPSize: 0.2-1mg

Request Quote

Recombinant Urease subunit beta (ureB)

Recombinant Urease subunit beta (ureB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP452150BXPYeast1mgQuote
EP452150BXPE. coli1mgQuote
BP452150BXPBaculovirus200ugQuote
MP452150BXPMammalian Cell200ugQuote

Protein Information

SpeciesBurkholderia ambifaria (strain MC40-6)
UniProt IDB1YUG0
Gene NameureB; Locus:BamMC406_0791
Protein Name
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMIPGEILTDDGEHELNAGRPTLTVVVANTGDRPVQVGSHYHFFEANDALSFDRAAARGFR LNIAAGTAVRFEPGQTRTVELVELAGERAVYGFQGKVMGPL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review