Request QuoteCatalog Number: xP461469BXSSize: 0.2-1mg

Request Quote

Recombinant Urease subunit beta (ureB)

Recombinant Urease subunit beta (ureB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP461469BXSYeast1mgQuote
EP461469BXSE. coli1mgQuote
BP461469BXSBaculovirus200ugQuote
MP461469BXSMammalian Cell200ugQuote

Protein Information

SpeciesBurkholderia cepacia (strain J2315 / LMG 16656) (Burkholderia cenocepacia (strain J2315) )
UniProt IDB4ECC6
Gene NameureB; Locus:BceJ2315_30520; ORFs:BCAL3105
Protein Name
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMIPGEILTDDGEHELNAGRATRSLVVANTGDRPVQVGSHYHFFEVNDALSFDRAAARGFR LNIAAGTAVRFEPGQTRTVELVALAGERAVYGFQGKVMGPL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review