Request QuoteCatalog Number: xP431071CWZSize: 0.2-1mg

Request Quote

Recombinant Urease subunit beta (ureB)

Recombinant Urease subunit beta (ureB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP431071CWZYeast1mgQuote
EP431071CWZE. coli1mgQuote
BP431071CWZBaculovirus200ugQuote
MP431071CWZMammalian Cell200ugQuote

Protein Information

SpeciesClostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
UniProt IDA9KJS0
Gene NameureB; Locus:Cphy_0688
Protein NameUrease subunit beta
Region Expressed1-106
Expression Tag6xHis
Purity>90%
AA SequenceMKPGEYILKNEEITCNEGRRTIKITAVNTGDRPVQVGSHYHFYEVNSAIQFNREETIGMH LDIPAGTAVRFEPGDSKEVSLVDYAGERFVYGFNNKIDGKLDTRRN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review