Request QuoteCatalog Number: xP544269BXQSize: 0.2-1mg

Request Quote

Recombinant Urease subunit beta (ureB)

Recombinant Urease subunit beta (ureB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP544269BXQYeast1mgQuote
EP544269BXQE. coli1mgQuote
BP544269BXQBaculovirus200ugQuote
MP544269BXQMammalian Cell200ugQuote

Protein Information

SpeciesBurkholderia cenocepacia (strain MC0-3)
UniProt IDB1JX30
Gene NameureB; Locus:Bcenmc03_0871
Protein NameUrease subunit beta
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMIPGEILTDDGEHELNAGRATLSLVVANTGDRPVQVGSHYHFFEVNDALSFDRAVARGFR LNIAAGTAVRFEPGQTRTVELVALAGERAVYGFQGKVMGPL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review