Request QuoteCatalog Number: xP541081FGCSize: 0.2-1mg

Request Quote

Recombinant Urease subunit beta (ureB)

Recombinant Urease subunit beta (ureB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP541081FGCYeast1mgQuote
EP541081FGCE. coli1mgQuote
BP541081FGCBaculovirus200ugQuote
MP541081FGCMammalian Cell200ugQuote

Protein Information

SpeciesPseudomonas putida (strain W619)
UniProt IDB1J814
Gene NameureB; Locus:PputW619_2416
Protein NameUrease subunit beta
Region Expressed1-105
Expression Tag6xHis
Purity>90%
AA SequenceMIPGEIQVAAGDIELNVGRETVSVNVANHGDRPVQVGSHYHFYEVNDALVFDREPSRGFR LDIPAGTAVRFEPGQARTVQLVAYAGKREVYGFQGKVMGALEGKA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review