Request QuoteCatalog Number: xP514276RASize: 0.2-1mg

Request Quote

Recombinant UPF0767 protein C1orf212 homolog

Recombinant UPF0767 protein C1orf212 homolog can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514276RAYeast1mgQuote
EP514276RAE. coli1mgQuote
BP514276RABaculovirus200ugQuote
MP514276RAMammalian Cell200ugQuote

Protein Information

SpeciesRattus norvegicus (Rat)
UniProt IDD4ACP2
Gene Name
Protein NameUPF0767 protein C1orf212 homolog
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceMWPVLWTVVRTYAPYVTFPVAFVVGAVGYHLEWFIRGKDPQPVEEEKSILERREDRKLDE MLGKDHTQVVSLKDKLEFAPKAVLNRNRPEKN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review