Request QuoteCatalog Number: xP493185DJJSize: 0.2-1mg

Request Quote

Recombinant UPF0751 protein Dhaf_1351 (Dhaf_1351)

Recombinant UPF0751 protein Dhaf_1351 (Dhaf_1351) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP493185DJJYeast1mgQuote
EP493185DJJE. coli1mgQuote
BP493185DJJBaculovirus200ugQuote
MP493185DJJMammalian Cell200ugQuote

Protein Information

SpeciesDesulfitobacterium hafniense (strain DCB-2 / DSM 10664)
UniProt IDB8G289
Gene NameLocus:Dhaf_1351
Protein NameUPF0751 protein Dhaf_1351
Region Expressed1-102
Expression Tag6xHis
Purity>90%
AA SequenceMRIAIVGGQNHNQETYGKLLGKTGRVEIHFYDGIPKKHNKRNLEKLIKDVDLVIVILGAC SHASMWDTKKAAKKCHKEVLFSRGIGISSIVKQIAGKPAYTA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review