Request QuoteCatalog Number: xP501804BQGSize: 0.2-1mg

Request Quote

Recombinant UPF0751 protein BAMEG_A0107 (BAMEG_A0107)

Recombinant UPF0751 protein BAMEG_A0107 (BAMEG_A0107) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP501804BQGYeast1mgQuote
EP501804BQGE. coli1mgQuote
BP501804BQGBaculovirus200ugQuote
MP501804BQGMammalian Cell200ugQuote

Protein Information

SpeciesBacillus anthracis (strain CDC 684 / NRRL 3495)
UniProt IDC3LL81
Gene NameLocus:BAMEG_A0107
Protein NameUPF0751 protein BAMEG_A0107
Region Expressed1-99
Expression Tag6xHis
Purity>90%
AA SequenceMSTILVLGGSNGRTLEKLAKKRDCQVIFHDGKNHGGVKKTFRSVIKKCDVIVIQKGACGH VSIDVAKEYAKKYDVPLLFNQGFGGTGALEMGLKHLKAA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review