Request QuoteCatalog Number: xP489002SYWSize: 0.2-1mg

Request Quote

Recombinant UPF0745 protein swp_2294 (swp_2294)

Recombinant UPF0745 protein swp_2294 (swp_2294) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP489002SYWYeast1mgQuote
EP489002SYWE. coli1mgQuote
BP489002SYWBaculovirus200ugQuote
MP489002SYWMammalian Cell200ugQuote

Protein Information

SpeciesShewanella piezotolerans (strain WP3 / JCM 13877)
UniProt IDB8CNS1
Gene NameLocus:swp_2294
Protein NameUPF0745 protein swp_2294
Region Expressed1-93
Expression Tag6xHis
Purity>90%
AA SequenceMICAVYKSLRKADSYLFVEKRNEFERVPEALMAMFGEPQLVMMLPIDKRDHLGFADIKKV KAELKDKGFYLQLPPPVVNLLEQHKKDIGFNPE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review