Request QuoteCatalog Number: xP493049SYSSize: 0.2-1mg

Request Quote

Recombinant UPF0745 protein Sbal223_2423 (Sbal223_2423)

Recombinant UPF0745 protein Sbal223_2423 (Sbal223_2423) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP493049SYSYeast1mgQuote
EP493049SYSE. coli1mgQuote
BP493049SYSBaculovirus200ugQuote
MP493049SYSMammalian Cell200ugQuote

Protein Information

SpeciesShewanella baltica (strain OS223)
UniProt IDB8E7F9
Gene NameLocus:Sbal223_2423
Protein NameUPF0745 protein Sbal223_2423
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceMLCAVYKSSRKADTYLFVKKRDCFDDVPAPLMEMFGVPKLVMVFPIAKRDALGMADIQKV RAAMEENGFYLQIPPPQVNLLAEHKLSLGIKD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review