Request QuoteCatalog Number: xP465110DQYSize: 0.2-1mg

Request Quote

Recombinant UPF0745 protein CJA_2437 (CJA_2437)

Recombinant UPF0745 protein CJA_2437 (CJA_2437) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP465110DQYYeast1mgQuote
EP465110DQYE. coli1mgQuote
BP465110DQYBaculovirus200ugQuote
MP465110DQYMammalian Cell200ugQuote

Protein Information

SpeciesCellvibrio japonicus (strain Ueda107) (Pseudomonas fluorescens subsp. cellulosa)
UniProt IDB3PKG9
Gene NameLocus:CJA_2437
Protein Name
Region Expressed1-98
Expression Tag6xHis
Purity>90%
AA SequenceMKIIAEIYRSPKEEGMYLYVKKEEGLGRVPEELLTLFGKPQQAMVLLLTPEKKLANADIG KVIESLNDKGYYLQLPPRDLVDAEAKRIRTLNSKLSGH
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review