Request QuoteCatalog Number: xP459178AXISize: 0.2-1mg

Request Quote

Recombinant UPF0745 protein APP7_0754 (APP7_0754)

Recombinant UPF0745 protein APP7_0754 (APP7_0754) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP459178AXIYeast1mgQuote
EP459178AXIE. coli1mgQuote
BP459178AXIBaculovirus200ugQuote
MP459178AXIMammalian Cell200ugQuote

Protein Information

SpeciesActinobacillus pleuropneumoniae serotype 7 (strain AP76)
UniProt IDB3GXE7
Gene NameLocus:APP7_0754
Protein Name
Region Expressed1-97
Expression Tag6xHis
Purity>90%
AA SequenceMTMSTNLCAIYKSPKREGMFLYVAKRDQFDSVPEALRQMFGKPQFVMLFNLNGEKQLKRS KNEEVLQAIQTQGFFLQMPPPPENLLKTFLEQNRGEA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review