Request QuoteCatalog Number: xP386046BOSize: 0.2-1mg

Request Quote

Recombinant UPF0708 protein C6orf162 homolog

Recombinant UPF0708 protein C6orf162 homolog can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP386046BOYeast1mgQuote
EP386046BOE. coli1mgQuote
BP386046BOBaculovirus200ugQuote
MP386046BOMammalian Cell200ugQuote

Protein Information

SpeciesBos taurus (Bovine)
UniProt IDA2VDV9
Gene Name
Protein NameUPF0708 protein C6orf162 homolog
Region Expressed1-97
Expression Tag6xHis
Purity>90%
AA SequenceMSSAPEPPAFKKEPPKEKDLGNIGLRGVRTTTLFRAVNPELFIKPNKPVMAFGLITISLC VAYIGYLHATQENKKDLYEAIDSEGHSYMRRKTSKWD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review