Request QuoteCatalog Number: xP422393BOLSize: 0.2-1mg

Request Quote

Recombinant UPF0473 protein BPUM_2377 (BPUM_2377)

Recombinant UPF0473 protein BPUM_2377 (BPUM_2377) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP422393BOLYeast1mgQuote
EP422393BOLE. coli1mgQuote
BP422393BOLBaculovirus200ugQuote
MP422393BOLMammalian Cell200ugQuote

Protein Information

SpeciesBacillus pumilus (strain SAFR-032)
UniProt IDA8FFM6
Gene NameLocus:BPUM_2377
Protein NameUPF0473 protein BPUM_2377
Region Expressed1-95
Expression Tag6xHis
Purity>90%
AA SequenceMEHGEKQITIVDDNGNEQLCEVLFTFESDHFNKSYVLYYPISEQDNEEIEIHASSFTPNE NGEDGELEPIETDEEWDMIEETLNTFLDQEEEDEE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review