Request QuoteCatalog Number: xP514349ENUSize: 0.2-1mg

Request Quote

Recombinant UPF0412 protein yaaI (yaaI)

Recombinant UPF0412 protein yaaI (yaaI) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514349ENUYeast1mgQuote
EP514349ENUE. coli1mgQuote
BP514349ENUBaculovirus200ugQuote
MP514349ENUMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli (strain K12 / MC4100 / BW2952)
UniProt IDC4ZPT9
Gene NameyaaI; Locus:BWG_0012
Protein NameUPF0412 protein yaaI
Region Expressed24-134
Expression Tag6xHis
Purity>90%
AA SequenceNDHKLLGAIAMPRNETNDLALKLPVCRIVKRIQLSADHGDLQLSGASVYFKAARSASQSL NIPSEIKEGQTTDWININSDNDNKRCVSKITFSGHTVNSSDMATLKIIGDD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review