Request QuoteCatalog Number: xP428669SUMSize: 0.2-1mg

Request Quote

Recombinant UPF0358 protein USA300HOU_1050 (USA300HOU_1050)

Recombinant UPF0358 protein USA300HOU_1050 (USA300HOU_1050) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP428669SUMYeast1mgQuote
EP428669SUME. coli1mgQuote
BP428669SUMBaculovirus200ugQuote
MP428669SUMMammalian Cell200ugQuote

Protein Information

SpeciesStaphylococcus aureus (strain USA300 / TCH1516)
UniProt IDA8Z1P7
Gene NameLocus:USA300HOU_1050
Protein NameUPF0358 protein USA300HOU_1050
Region Expressed1-91
Expression Tag6xHis
Purity>90%
AA SequenceMAKQATMKNAALKQLTKDADEILHLIKVQLDNLTLPSCPLYEEVLDTQMFGLQKEVDFAV KLGLVDREDGKQIMLRLEKELSKLHEAFTLV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review