Request QuoteCatalog Number: xP505934BWLSize: 0.2-1mg

Request Quote

Recombinant UPF0358 protein BBR47_22520 (BBR47_22520)

Recombinant UPF0358 protein BBR47_22520 (BBR47_22520) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP505934BWLYeast1mgQuote
EP505934BWLE. coli1mgQuote
BP505934BWLBaculovirus200ugQuote
MP505934BWLMammalian Cell200ugQuote

Protein Information

SpeciesBrevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
UniProt IDC0ZBS0
Gene NameLocus:BBR47_22520
Protein NameUPF0358 protein BBR47_22520
Region Expressed1-93
Expression Tag6xHis
Purity>90%
AA SequenceMTEIKVPDLEQKALALLQADADKIYKLIDVQMENLTMPQCPLYEEVLDTQMFGLSREVEY AVRLGLISDDIGREIMGSLERKLAHLHELFNQR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review