Request QuoteCatalog Number: xP498909SWUSize: 0.2-1mg

Request Quote

Recombinant UPF0345 protein YaiE (yaiE)

Recombinant UPF0345 protein YaiE (yaiE) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP498909SWUYeast1mgQuote
EP498909SWUE. coli1mgQuote
BP498909SWUBaculovirus200ugQuote
MP498909SWUMammalian Cell200ugQuote

Protein Information

SpeciesSalmonella paratyphi C (strain RKS4594)
UniProt IDC0Q7R4
Gene NameyaiE; Locus:SPC_0401
Protein NameUPF0345 protein YaiE
Region Expressed1-94
Expression Tag6xHis
Purity>90%
AA SequenceMLQSNEYFSGKVKSIGFTSSSTGRASVGVMAEGEYTFGTAEPEEMTVVSGALKVLLPGTV EWKVYTAGEVFNVPVHSEFHLQVAEPTSYLCRYL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review