Request QuoteCatalog Number: xP504827TOQSize: 0.2-1mg

Request Quote

Recombinant UPF0345 protein Tola_0192 (Tola_0192)

Recombinant UPF0345 protein Tola_0192 (Tola_0192) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP504827TOQYeast1mgQuote
EP504827TOQE. coli1mgQuote
BP504827TOQBaculovirus200ugQuote
MP504827TOQMammalian Cell200ugQuote

Protein Information

SpeciesTolumonas auensis (strain DSM 9187 / TA4)
UniProt IDC4L823
Gene NameLocus:Tola_0192
Protein NameUPF0345 protein Tola_0192
Region Expressed1-93
Expression Tag6xHis
Purity>90%
AA SequenceMLQVNEYFSGNVKSIGFDLADQRATVGVMAPGEYEFGTGAPELMVVIRGALTVQLPGATE WQTFSAGQEFNVPGNSKFQLKVATDTAYLCEYK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review